compare

Comparison List

WasCFP

a.k.a. W in anionic state CFP

WasCFP is a basic (constitutively fluorescent) green fluorescent protein published in 2012, derived from Aequorea victoria. It has high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.8 kDa -

FPbase ID: V7NZK

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
494 505 51,000 0.85 43.35 6.9   5.1
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

WasCFP Sequence

BLAST

WasCFP was derived from mCerulean with the following mutations: V61K/D148G/Y151N/L207Q
amino acid numbers relative to avGFP. show relative to mCerulean

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLKTTLTWGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNAISGNVNITADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKQSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for WasCFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Tryptophan-based chromophore in fluorescent proteins can be anionic

Sarkisyan Ks, Yampolsky Iv, Solntsev Km, Lukyanov Sa, Lukyanov Ka, Mishin As

(2012). Scientific Reports, 2(1) , 608. doi: 10.1038/srep00608. Article   Pubmed

Additional References

  1. Three-dimensional structure of a pH-dependent fluorescent protein WasCFP with a tryptophan based deprotonated chromophore

    Pletnev Vz, Pletneva Nv, Efremov Rg, Goryacheva Ea, Artemyev Iv, Arkhipova Sf, Sarkisyan Ks, Mishin As, Lukyanov Ka, Pletnev Sv

    (2017). Russian Journal of Bioorganic Chemistry, 42(6) , 612-618. doi: 10.1134/s1068162016050149. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change