compare

Comparison List

Neptune

similar: mNeptune

Neptune is a basic (constitutively fluorescent) far red fluorescent protein published in 2009, derived from Entacmaea quadricolor. It is reported to be a rapidly-maturing dimer with moderate acid sensitivity.
+
Neptune Spectrum Fluorescent protein Neptune excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Dimer Entacmaea quadricolor 27.4 kDa -

FPbase ID: Z3GLX

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
600 650 72,000 0.18 12.96 5.8 35.0  

Photostability

No photostability measurements available ... add one!

Neptune Sequence

Neptune was derived from mKate with the following mutations: S2_S2delinsVSKGE/M41G/S61C/S158C/Y194F/*230LextNGMDELYK
amino acid numbers relative to eqFP578. show relative to mKate

MVSKGEELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTGRIKVVEGGPLPFAFDILATCFMYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTEMLYPADGGLEGRCDMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYFVDRRLERIKEADKETYVEQHEVAVARYCDLPSKLGHKLNGMDELYK
GenBank: ACZ95825
IPG: 19025957

Structure

Deposited: ,
Chromophore (MYG):

Excerpts

No excerpts have been added for Neptune
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change