compare

Comparison List

mNeptune

a.k.a. mNeptune1

similar: Neptune

mNeptune is a basic (constitutively fluorescent) far red fluorescent protein published in 2009, derived from Entacmaea quadricolor. It is reported to be a rapidly-maturing monomer with moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 27.4 kDa -

FPbase ID: 1LT8G

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
600 650 67,000 0.2 13.4 5.4 35.0  

mNeptune OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
40.5 ± 3.8 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
255.0   Lin et al. (2009)
500.0 Widefield 25.0 Luker et al. (2015)

mNeptune Sequence

mNeptune was derived from Neptune with the following mutations: M146T
amino acid numbers relative to eqFP578. show relative to Neptune

MVSKGEELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTGRIKVVEGGPLPFAFDILATCFMYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTETLYPADGGLEGRCDMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYFVDRRLERIKEADKETYVEQHEVAVARYCDLPSKLGHKLNGMDELYK
GenBank: ACZ95826
IPG: 19025958

Excerpts

No excerpts have been added for mNeptune
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change