compare

Comparison List

mWasabi

mWasabi is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Clavularia sp.. It has high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Clavularia sp. 26.9 kDa -

FPbase ID: QTBVW

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
493 509 70,000 0.8 56.0 6.5    

mWasabi OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
86.4 ± 2.5 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
93.0   Ai et al. (2008)

mWasabi Sequence

mWasabi was derived from G2 with the following mutations: A104S/M177E/S254I
amino acid numbers relative to cFP484. show relative to G2

MVSKGEETTMGVIKPDMKIKLKMEGNVNGHAFVIEGEGEGKPYDGTNTINLEVKEGAPLPFSYDILTTAFSYGNRAFTKYPDDIPNYFKQSFPEGYSWERTMTFEDKGIVKVKSDISMEEDSFIYEIHLKGENFPPNGPVMQKETTGWDASTERMYVRDGVLKGDVKMKLLLEGGGHHRVDFKTIYRAKKAVKLPDYHFVDHRIEILNHDKDYNKVTVYEIAVARNSTDGMDELYK
GenBank: ABW74902.1

Excerpts

No excerpts have been added for mWasabi
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change