compare

Comparison List

G2

G2 is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Clavularia sp..

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Clavularia sp. 26.9 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
487 503 39,000 0.65 25.35      

Photostability

no photostability measurements available ... add one!

G2 Sequence

G2 was derived from G1 with the following mutations: K177M
amino acid numbers relative to cFP484. show relative to G1

MVSKGEETTMGVIKPDMKIKLKMEGNVNGHAFVIEGEGEGKPYDGTNTINLEVKEGAPLPFSYDILTTAFAYGNRAFTKYPDDIPNYFKQSFPEGYSWERTMTFEDKGIVKVKSDISMEEDSFIYEIHLKGENFPPNGPVMQKMTTGWDASTERMYVRDGVLKGDVKMKLLLEGGGHHRVDFKTIYRAKKAVKLPDYHFVDHRIEILNHDKDYNKVTVYESAVARNSTDGMDELYK

Excerpts

No excerpts have been added for G2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change