compare

Comparison List

mTurquoise

mTurquoise is a basic (constitutively fluorescent) cyan fluorescent protein published in 2010, derived from Aequorea victoria. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.9 kDa -

FPbase ID: 5E826

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
434 474 30,000 0.84 25.2 4.5 112.2 3.7
Edit States/Attributes

mTurquoise OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
93.3 ± 1.2 (10000 cells) - HeLa Cranfill et al. (2016)
93.8 ± 1.0 (10000 cells) - HeLa Shaner et al. (2013)

Photostability

No photostability measurements available ... add one!

mTurquoise Sequence

BLAST

mTurquoise was derived from SCFP3A with the following mutations: T65S
amino acid numbers relative to avGFP. show relative to SCFP3A

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSWGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYISDNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Structure

Deposited: ,
Chromophore (SWG):

Excerpts

No excerpts have been added for mTurquoise
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Bright cyan fluorescent protein variants identified by fluorescence lifetime screening

Goedhart J, Van Weeren L, Hink Ma, Vischer Noe, Jalink K, Gadella Twj

(2010). Nature Methods, 7(2) , 137-139. doi: 10.1038/nmeth.1415. Article   Pubmed

Additional References

  1. Systematic characterization of maturation time of fluorescent proteins in living cells

    Balleza E, Kim Jm, Cluzel P

    (2017). Nature Methods, 15(1) , 47-51. doi: 10.1038/nmeth.4509. Article   Pubmed

  2. An Improved Cerulean Fluorescent Protein with Enhanced Brightness and Reduced Reversible Photoswitching

    Markwardt Ml, Kremers G-J, Kraft Ca, Ray K, Cranfill Pjc, Wilson Ka, Day Rn, Wachter Rm, Davidson Mw, Rizzo Ma

    (2011). PLoS ONE, 6(3) , e17896. doi: 10.1371/journal.pone.0017896. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change