compare

Comparison List

mTFP1-Y67H

mTFP1-Y67H is a fluorescent protein published in 2008, derived from Clavularia sp.. It is reported to be a monomer.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Clavularia sp. 26.9 kDa -

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

no photostability measurements available ... add one!

mTFP1-Y67H Sequence

MVSKGEETTMGVIKPDMKIKLKMEGNVNGHAFVIEGEGEGKPYDGTNTINLEVKEGAPLPFSYDILTTAFAHGNRAFTKYPDDIPNYFKQSFPEGYSWERTMTFEDKGIVKVKSDISMEEDSFIYEIHLKGENFPPNGPVMQKKTTGWDASTERMYVRDGVLKGDVKHKLLLEGGGHHRVDFKTIYRAKKAVKLPDYHFVDHRIEILNHDKDYNKVTVYESAVARNSTDGMDELYK

Excerpts

The purified mTFP1-Y67H variant exhibited no significant fluorescence, but did have a strong absorbance peak that was blue-shifted by 10.5 nm (mean wavelength at half maximum intensity relative to avGFP-derived EBFP

Ai et al. (2008)

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change