compare

Comparison List

mTFP1-Y67H

mTFP1-Y67H is a fluorescent protein published in 2008, derived from Clavularia sp.. It is reported to be a monomer.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Monomer Clavularia sp. 26.9 kDa -

FPbase ID: KQ1PU

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

mTFP1-Y67H Sequence

BLAST
MVSKGEETTMGVIKPDMKIKLKMEGNVNGHAFVIEGEGEGKPYDGTNTINLEVKEGAPLPFSYDILTTAFAHGNRAFTKYPDDIPNYFKQSFPEGYSWERTMTFEDKGIVKVKSDISMEEDSFIYEIHLKGENFPPNGPVMQKKTTGWDASTERMYVRDGVLKGDVKHKLLLEGGGHHRVDFKTIYRAKKAVKLPDYHFVDHRIEILNHDKDYNKVTVYESAVARNSTDGMDELYK

Excerpts

The purified mTFP1-Y67H variant exhibited no significant fluorescence, but did have a strong absorbance peak that was blue-shifted by 10.5 nm (mean wavelength at half maximum intensity relative to avGFP-derived EBFP

Ai et al. (2008)

Primary Reference

Hue-shifted monomeric variants of Clavularia cyan fluorescent protein: identification of the molecular determinants of color and applications in fluorescence imaging

Ai H-, Olenych Sg, Wong P, Davidson Mw, Campbell Re

(2008). BMC Biology, 6(1) , 13. doi: 10.1186/1741-7007-6-13. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change