compare

Comparison List

mStayGold

a.k.a. mSG, StayGold E138D

similar: StayGold

mStayGold is a basic (constitutively fluorescent) green fluorescent protein published in 2023, derived from Cytaeis uchidae. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Cytaeis uchidae 24.6 kDa -

FPbase ID: Q8WTP

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
497 504 145,000 0.87 126.15 4.6    

Photostability

No photostability measurements available ... add one!

mStayGold Sequence

mStayGold was derived from StayGold with the following mutations: E138D

MASTPFKFQLKGTINGKSFTVEGEGEGNSHEGSHKGKYVCTSGKLPMSWAALGTSFGYGMKYYTKYPSGLKNWFHEVMPEGFTYDRHIQYKGDGSIHAKHQHFMKNGTYHNIVEFTGQDFKENSPVLTGDMNVSLPNDVQHIPRDDGVECPVTLLYPLLSDKSKCVEAHQNTICKPLHNQPAPDVPYHWIRKQYTQSKDDTEERDHICQSETLEAHL

Excerpts

No excerpts have been added for mStayGold
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change