compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

mStayGold

a.k.a. QC2-6 FIQ

mStayGold is a basic (constitutively fluorescent) green fluorescent protein published in 2023, derived from Cytaeis uchidae. It has low acid sensitivity.

⁺

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Cytaeis uchidae	25.6 kDa	-

FPbase ID: 5H7QY

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
499	510	164,000	0.83	136.12	4.8		2.79

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mStayGold Sequence

BLAST

mStayGold was derived from QC2-6 with the following mutations: R153I/T164Q/Y196FR144I/T155Q/Y187F
amino acid numbers relative to QC2-6CU17S. show relative to CU17S show relative to QC2-6

MVSTGEELFTGVVPFKFQLKGTINGKSFTVEGEGEGNSHEGSHKGKYVCTSGKLPMSWAALGTSFGYGMKYYTKYPSGLKNWFHEVMPEGFTYDRHIQYKGDGSIHAKHQHFMKNGTYHNIVEFTGQDFKENSPVLTGDMDVSLPNEVQHIPIDDGVECTVTLQYPLLSDESKCVEAYQNTIIKPLHNQPAPDVPFHWIRKQYTQSKDDTEERDHIIQSETLEAHL

GenBank: LC756333

Excerpts

We noticed, that QC2-6 yielded a substantial number of puncta in a Fluoppi assay (score, 55.6%). With this unacceptable result, we decided to drive the monomerization further on the basis of QC2-6. Performing combinatorial saturation mutagenesis at Tyr187, Arg144 and Thr155 and screening for brightness, photostability and monomericity yielded QC2-6 FIQ, which contained Y187F, R144I and T155Q mutations relative to QC2-6. QC2-6 FIQ gave high scores for both OSER (92.3%) and Fluoppi (100%) assays.

Ando et al. (2023)