compare

Comparison List

mScarlet-H

mScarlet-H is a basic (constitutively fluorescent) orange fluorescent protein published in 2016, derived from synthetic construct. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer synthetic construct 26.4 kDa -

FPbase ID: 588N2

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
551 592 74,000 0.2 14.8 4.8 264.0 1.3
Edit States/Attributes

mScarlet-H OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
82.0 (284 cells) 2.2 ± 0.2 (33 cells) U-2 OS Bindels et al. (2016)

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
574.0 6.9 (W/cm2) Arc-lamp Widefield H2A 37.0 Bindels et al. (2016)
368.0 1.35 (W/cm2) Laser Spinning Disc Confocal H2A 37.0 Bindels et al. (2016)
A caution on interpretation of photostability measurements
Add photostability info

mScarlet-H Sequence

BLAST

mScarlet-H was derived from mScarlet with the following mutations: M164H

MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWDILSPQFMYGSRAFTKHPADIPDYYKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLIYKVKLRGTNFPPDGPVMQKKTMGWEASTERLYPEDGVLKGDIKHALRLKDGGRYLADFKTTYKAKKPVQMPGAYNVDRKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK
GenBank: APD76537
IPG: 129830966

Excerpts

Screening for a more photostable mScarlet variant yielded mScarlet-H, with a single amino acid substitution (M164H) causing a >2-fold improvement in photostability, albeit accompanied by a serious decrease in quantum yield and fluorescence lifetime.

Bindels et al. (2016)

Primary Reference

mScarlet: a bright monomeric red fluorescent protein for cellular imaging

Bindels Ds, Haarbosch L, Van Weeren L, Postma M, Wiese Ke, Mastop M, Aumonier S, Gotthard G, Royant A, Hink Ma, Gadella Twj

(2016). Nature Methods, 14(1) , 53-56. doi: 10.1038/nmeth.4074. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change