compare

Comparison List

mRed7

mRed7 is a synthetic gene template based on mCherry and multiple other naturally occurring RFPs and chromo proteins. It was the starting template used in the evolution of mScarlet.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer synthetic construct 26.2 kDa -

FPbase ID: 1NW9S

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
589 606         0.43
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mRed7 Sequence

BLAST

Note: mRed7 is a synthetic gene template based on mCherry and multiple other naturally occurring RFPs and chromo proteins

MVSKGEEVIKEFMQFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYFKLSFPEGFKWERVMNFEDGGAVTVTQDSSLEDGTLIYKVKFRGTNFPPDGPVMQKKTMGWEPSTERLYPQDGVLKGEISQALKLKDGGHYLVDFKTTYMAKKPVQLPGAYNVDTKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK

Excerpts

To start the development of a new monomeric RFP, a new synthetic template was designed based on the good maturating monomeric RFP mCherry... While designed to adopt the general fold of DsRed and mCherry (specifically concerning the conserved internal alpha helix), mRed7 harbors 30 amino acid changes as compared to mCherry and 44 as compared to DsRed.

Bindels et al. (2016)

Primary Reference

mScarlet: a bright monomeric red fluorescent protein for cellular imaging

Bindels Ds, Haarbosch L, Van Weeren L, Postma M, Wiese Ke, Mastop M, Aumonier S, Gotthard G, Royant A, Hink Ma, Gadella Twj

(2016). Nature Methods, 14(1) , 53-56. doi: 10.1038/nmeth.4074. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change