compare

Comparison List

mRed7

mRed7 is a basic (constitutively fluorescent) red fluorescent protein published in 2016, derived from synthetic construct.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer synthetic construct 26.2 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
589 606         0.43

Photostability

no photostability measurements available ... add one!

mRed7 Sequence

Note: mRed7 is a synthetic gene template based on mCherry and multiple other naturally occurring RFPs and chromo proteins

MVSKGEEVIKEFMQFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYFKLSFPEGFKWERVMNFEDGGAVTVTQDSSLEDGTLIYKVKFRGTNFPPDGPVMQKKTMGWEPSTERLYPQDGVLKGEISQALKLKDGGHYLVDFKTTYMAKKPVQLPGAYNVDTKLDITSHNEDYTVVEQYERSEGRHSTGGMDELYK

Excerpts

To start the development of a new monomeric RFP, a new synthetic template was designed based on the good maturating monomeric RFP mCherry... While designed to adopt the general fold of DsRed and mCherry (specifically concerning the conserved internal alpha helix), mRed7 harbors 30 amino acid changes as compared to mCherry and 44 as compared to DsRed.

Bindels et al. (2016)

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change