compare

Comparison List

mRaspberry

mRaspberry is a basic (constitutively fluorescent) red fluorescent protein published in 2004, derived from Discosoma sp..
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 25.5 kDa -

FPbase ID: V5FM2

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
598 625 86,000 0.15 12.9      

mRaspberry OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
89.6 ± 4.0 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

No photostability measurements available ... add one!

mRaspberry Sequence

mRaspberry was derived from mRFP1.2 with the following mutations: F65C/A71G/I161M
amino acid numbers relative to DsRed. show relative to mRFP1.2

MVSKGEEVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQCMYGSKGYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEMKMRLKLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKLDITSHNEDYTIVEQYERAEGRHSTGA
GenBank: AAV65486
UniProtKB: Q5S3G8
IPG: 3877009

Excerpts

No excerpts have been added for mRaspberry
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Evolution of new nonantibody proteins via iterative somatic hypermutation

Wang L, Jackson Wc, Steinbach Pa, Tsien Ry

(2004). Proceedings of the National Academy of Sciences, 101(48) , 16745-16749. doi: 10.1073/pnas.0407752101. Article   Pubmed

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change