compare

Comparison List

moxEos3.2

moxEos3.2 is a fluorescent protein published in 2017, derived from Lobophyllia hemprichii. It is reported to be a monomer.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Lobophyllia hemprichii 25.7 kDa -

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

no photostability measurements available ... add one!

moxEos3.2 Sequence

MVSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFHYGNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDGGIANARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIEMALLLEGNAHYRADFRTTYKAKEKGVKLPGAHFVDHAIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

No excerpts have been added for moxEos3.2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

moxDendra2: an inert photoswitchable protein for oxidizing environments

Kaberniuk Aa, Morano Nc, Verkhusha Vv, Snapp El

(2017). Chemical Communications, 53(13) , 2106-2109. doi: 10.1039/c6cc09997a. Article   Pubmed

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change