compare

Comparison List

mLumin

mLumin is a basic (constitutively fluorescent) red fluorescent protein published in 2009, derived from Entacmaea quadricolor. It is reported to be a slowly-maturing monomer with low acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.0 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
587 621 70,000 0.46 32.2 4.7 76.0  

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
166.0 Chu et al. (2009)

mLumin Sequence

MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEAATEMLYPADGGLEGRSDMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKLGHK

Excerpts

No excerpts have been added for mLumin
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change