compare

Comparison List

mKO

a.k.a. mKusabira-Orange, mKO1

similar: KO

mKO is a basic (constitutively fluorescent) orange fluorescent protein published in 2004, derived from Verrillofungia concinna. It has low acid sensitivity.
+
mKO Spectrum Fluorescent protein mKO excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Verrillofungia concinna 24.5 kDa -

FPbase ID: RR1M4

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
548 559 51,600 0.6 30.96 5.0   4.1

mKO OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
46.9 ± 6.1 (10000 cells) - HeLa Cranfill et al. (2016)

Photostability

No photostability measurements available ... add one!

mKO Sequence

mKO was derived from KO with the following mutations: M1_S2insV/K11R/F13Y/V25I/K32R/S55A/T62V/Q96E/F102S/A104S/C115T/E117Y/V123T/V133I/S139V/T150A/C151S/F162Y/A166E/Q190G/F193Y/G195S/C217S

MVSVIKPEMKMRYYMDGSVNGHEFTIEGEGTGRPYEGHQEMTLRVTMAKGGPMPFAFDLVSHVFCYGHRPFTKYPEEIPDYFKQAFPEGLSWERSLEFEDGGSASVSAHISLRGNTFYHKSKFTGVNFPADGPIMQNQSVDWEPSTEKITASDGVLKGDVTMYLKLEGGGNHKCQFKTTYKAAKKILKMPGSHYISHRLVRKTEGNITELVEDAVAHS
GenBank: BAD24722
UniProtKB: Q6I7B2
IPG: 3504947

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for mKO
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change