compare

Comparison List

KO

a.k.a. Kusabira-Orange, KO1

similar: mKO

KO is a basic (constitutively fluorescent) orange fluorescent protein published in 2004, derived from Verrillofungia concinna. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Verrillofungia concinna 24.3 kDa -

FPbase ID: A8BXL

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
548 561 109,750 0.45 49.39 5.0   4.2
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

KO Sequence

BLAST
MSVIKPEMKMKYFMDGSVNGHEFTVEGEGTGKPYEGHQEMTLRVTMAKGGPMPFSFDLVSHTFCYGHRPFTKYPEEIPDYFKQAFPEGLSWERSLQFEDGGFAAVSAHISLRGNCFEHKSKFVGVNFPADGPVMQNQSSDWEPSTEKITTCDGVLKGDVTMFLKLAGGGNHKCQFKTTYKAAKKILKMPQSHFIGHRLVRKTEGNITELVEDAVAHC
GenBank: BAD24721
UniProtKB: Q6I7B3
IPG: 3504951

Excerpts

No excerpts have been added for KO
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Cyan-emitting and orange-emitting fluorescent proteins as a donor/acceptor pair for fluorescence resonance energy transfer

Karasawa S, Araki T, Nagai T, Mizuno H, Miyawaki A

(2004). Biochemical Journal, 381(1) , 307-312. doi: 10.1042/bj20040321. Article   Pubmed

Additional References

  1. Transgenic-Cloned Pigs Systemically Expressing Red Fluorescent Protein, Kusabira-Orange

    Matsunari H, Onodera M, Tada N, Mochizuki H, Karasawa S, Haruyama E, Nakayama N, Saito H, Ueno S, Kurome M, Miyawaki A, Nagashima H

    (2008). Cloning and Stem Cells, 10(3) , 313-324. doi: 10.1089/clo.2008.0024. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change