compare

Comparison List

mKate S158A

a.k.a. mLumin

mKate S158A is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Entacmaea quadricolor. It has moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.0 kDa -

FPbase ID: BRFP4

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
585 630 75,000 0.3 22.5 5.4    

Photostability

No photostability measurements available ... add one!

mKate S158A Sequence

mKate S158A was derived from mKate with the following mutations: S158A

MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTEMLYPADGGLEGRADMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKLGHK

Excerpts

No excerpts have been added for mKate S158A
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change