compare

Comparison List

mKate S158A

a.k.a. mLumin

mKate S158A is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Entacmaea quadricolor. It has moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.0 kDa -

FPbase ID: BRFP4

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
585 630 75,000 0.3 22.5 5.4    
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mKate S158A Sequence

BLAST

mKate S158A was derived from mKate with the following mutations: S158A

MSELIKENMHMKLYMEGTVNNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFINHTQGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKIRGVNFPSNGPVMQKKTLGWEASTEMLYPADGGLEGRADMALKLVGGGHLICNLKTTYRSKKPAKNLKMPGVYYVDRRLERIKEADKETYVEQHEVAVARYCDLPSKLGHK

Excerpts

No excerpts have been added for mKate S158A
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A Crystallographic Study of Bright Far-Red Fluorescent Protein mKate Reveals pH-inducedcis-transIsomerization of the Chromophore

Pletnev S, Shcherbo D, Chudakov Dm, Pletneva N, Merzlyak Em, Wlodawer A, Dauter Z, Pletnev V

(2008). Journal of Biological Chemistry, 283(43) , 28980-28987. doi: 10.1074/jbc.m800599200. Article   Pubmed

Additional References

  1. Autofluorescent Proteins with Excitation in the Optical Window for Intravital Imaging in Mammals

    Lin Mz, Mckeown Mr, Ng H-L, Aguilera Ta, Shaner Nc, Campbell Re, Adams Sr, Gross La, Ma W, Alber T, Tsien Ry

    (2009). Chemistry & Biology, 16(11) , 1169-1179. doi: 10.1016/j.chembiol.2009.10.009. Article   Pubmed

  2. A novel far-red bimolecular fluorescence complementation system that allows for efficient visualization of protein interactions under physiological conditions

    Chu J, Zhang Z, Zheng Y, Yang J, Qin L, Lu J, Huang Z-L, Zeng S, Luo Q

    (2009). Biosensors and Bioelectronics, 25(1) , 234-239. doi: 10.1016/j.bios.2009.06.008. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change