compare

Comparison List

mKalama1

mKalama1 is a basic (constitutively fluorescent) blue fluorescent protein published in 2007, derived from Aequorea victoria. It has moderate acid sensitivity.
+
mKalama1 Spectrum Fluorescent protein mKalama1 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.8 kDa -

FPbase ID: TUONH

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
385 456 36,000 0.45 16.2 5.5    

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
2.5   Ai et al. (2007)

mKalama1 Sequence

mKalama1 was derived from EGFP with the following mutations: L18M/H25R/S30R/E32V/Y39H/T50S/T65S/N105S/E124V/I128T/Y145M/S147V/H148G/M153T/V163A/K166E/I171V/S175G/P192S/T203V/S205V/A206K/V224R/L231P
amino acid numbers relative to avGFP. show relative to EGFP

MVSKGEELFTGVVPILVEMDGDVNGRKFSVRGVGEGDATHGKLTLKFICTSGKLPVPWPTLVTTLSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGSYKTRAEVKFEGDTLVNRIVLKGTDFKEDGNILGHKLEYNMNVGNVYITADKQKNGIKANFEIRHNVEDGGVQLADHYQQNTPIGDGSVLLPDNHYLSVQVKLSKDPNEKRDHMVLLEFRTAAGITPGMDELYK
GenBank: ABP88742
IPG: 12966091

Excerpts

No excerpts have been added for mKalama1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change