compare

Comparison List

miRFP670nano

miRFP670nano is a basic (constitutively fluorescent) near ir fluorescent protein published in 2019, derived from Nostoc punctiforme. It has very low acid sensitivity. It requires the cofactor biliverdin for fluorescence.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Nostoc punctiforme 17.1 kDa Biliverdin

FPbase ID: 1KNNM

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
645 670 95,000 0.108 10.26 3.7 100.0  
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

miRFP670nano Sequence

BLAST

miRFP670nano was derived from NpR3784g with the following mutations: V7M/F25C/M26V/Y27F/P31E/S41A/A48S/N51K/Q55R/T57R/I72Y/G82N/H87Y/N99I/N117H/L136Q/Q139V/Q148_L149del

MANLDKMLNTTVTEVRQFLQVDRVCVFQFEEDYSGVVVVEAVDDRWISILKTQVRDRYFMETRGEEYSHGRYQAIADIYTANLTECYRDLLTQFQVRAILAVPILQGKKLWGLLVAHQLAAPRQWQTWEIDFLKQQAVVVGIAIQQS
GenBank: MK176509

Structure

Deposited: ,
Chromophore:

Excerpts

Unlike BphP-derived NIR FPs, miRFP670nano is highly stable to denaturation and degradation and can be used as an internal protein tag.

Oliinyk et al. (2019)

miRFP670nano is an effective FRET donor for red-shifted NIR FPs, enabling engineering NIR FRET biosensors spectrally compatible with GFP-like FPs and blue–green optogenetic tools

Oliinyk et al. (2019)

Primary Reference

Smallest near-infrared fluorescent protein evolved from cyanobacteriochrome as versatile tag for spectral multiplexing

Oliinyk Os, Shemetov Aa, Pletnev S, Shcherbakova Dm, Verkhusha Vv

(2019). Nature Communications, 10(1) , 279. doi: 10.1038/s41467-018-08050-8. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change