compare

Comparison List

mGeos-F

mGeos-F is a photoswitchable green fluorescent protein published in 2012, derived from Lobophyllia hemprichii. It has low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Lobophyllia hemprichii 25.9 kDa -

FPbase ID: H8UXC

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
On 504 515 53,135 0.85 45.16 5.0    
Off              

Transitions

From To Switch λ
Off On 405
On Off 488

Photostability

No photostability measurements available ... add one!

mGeos-F Sequence

mGeos-F was derived from mEos2 with the following mutations: H62F

MSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFFYGNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIHMALLLEGNAHYRCDFRTTYKAKEKGVKLPGYHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

No excerpts have been added for mGeos-F
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A unique series of reversibly switchable fluorescent proteins with beneficial properties for various applications

Chang H, Zhang M, Ji W, Chen J, Zhang Y, Liu B, Lu J, Zhang J, Xu P, Xu T

(2012). Proceedings of the National Academy of Sciences, 109(12) , 4455-4460. doi: 10.1073/pnas.1113770109. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change