compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

mGeos-E

mGeos-E is a photoswitchable green fluorescent protein published in 2012, derived from Lobophyllia hemprichii. It has moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Lobophyllia hemprichii	25.8 kDa	-

FPbase ID: 5WALF

Attributes

State	Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
On	501	513	69,630	0.75	52.22	6.0
Off

Edit States/Attributes

Transitions

From	To	Switch λ
Off	On	405
On	Off	488

Edit state transitions

Photostability

No photostability measurements available ... add one!

mGeos-E Sequence

BLAST

mGeos-E was derived from mEos2 with the following mutations: H62EH62E

MSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFEYGNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIHMALLLEGNAHYRCDFRTTYKAKEKGVKLPGYHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

No excerpts have been added for mGeos-E
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A unique series of reversibly switchable fluorescent proteins with beneficial properties for various applications

Chang H, Zhang M, Ji W, Chen J, Zhang Y, Liu B, Lu J, Zhang J, Xu P, Xu T

(2012). Proceedings of the National Academy of Sciences, 109(12) , 4455-4460. doi: 10.1073/pnas.1113770109. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for mGeos-E
Search RIKEN BRC for mGeos-E

Change history

Something missing or incorrect? Submit a change Submit a change