compare

Comparison List

mGeos-E

mGeos-E is a basic (constitutively fluorescent) green fluorescent protein published in 2012, derived from Lobophyllia hemprichii. It has moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Lobophyllia hemprichii 25.8 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
501 513 69,630 0.75 52.22 6.0    

Photostability

no photostability measurements available ... add one!

mGeos-E Sequence

MSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFEYGNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIHMALLLEGNAHYRCDFRTTYKAKEKGVKLPGYHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

No excerpts have been added for mGeos-E
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A unique series of reversibly switchable fluorescent proteins with beneficial properties for various applications

Chang H, Zhang M, Ji W, Chen J, Zhang Y, Liu B, Lu J, Zhang J, Xu P, Xu T

(2012). Proceedings of the National Academy of Sciences, 109(12) , 4455-4460. doi: 10.1073/pnas.1113770109. Article   Pubmed

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change