compare

Comparison List

mEos2-A69T

mEos2-A69T is a photoconvertible red fluorescent protein published in 2016, derived from Lobophyllia hemprichii. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Lobophyllia hemprichii 25.9 kDa -

FPbase ID: YJY7C

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Orange 565 580 11,500 0.66 7.59 7.4   4.2
Green 495 509 24,300 0.63 15.31 8.2   3.4

Transitions

From To Switch λ
Green Orange 405

Photostability

No photostability measurements available ... add one!

mEos2-A69T Sequence

mEos2-A69T was derived from mEos2 with the following mutations: A69T

MSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFHYGNRVFTKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIHMALLLEGNAHYRCDFRTTYKAKEKGVKLPGYHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for mEos2-A69T
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Arginine 66 Controls Dark-State Formation in Green-to-Red Photoconvertible Fluorescent Proteins

Berardozzi R, Adam V, Martins A, Bourgeois D

(2016). Journal of the American Chemical Society, 138(2) , 558-565. doi: 10.1021/jacs.5b09923. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change