compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

mEos2-A69T

You are viewing an older revision of this protein, from Jan 16, 2019 15:37:24. Click here to view the current version.

mEos2-A69T is a photoconvertible red fluorescent protein published in 2016, derived from Lobophyllia hemprichii. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
Monomer	Lobophyllia hemprichii	25.9 kDa	-

FPbase ID: YJY7C

Attributes

State	Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
Green	495	509	24,300	0.63	15.31	8.2		3.4
Orange	565	580	11,500	0.66	7.59	7.4		4.2

Edit States/Attributes

Transitions

From	To	Switch λ
Green	Orange	405

Edit state transitions

Photostability

No photostability measurements available ... add one!

mEos2-A69T Sequence

BLAST

mEos2-A69T was derived from mEos2 with the following mutations: A69TA69T

MSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFHYGNRVFTKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIHMALLLEGNAHYRCDFRTTYKAKEKGVKLPGYHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Structure

PDB ID

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for mEos2-A69T
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Arginine 66 Controls Dark-State Formation in Green-to-Red Photoconvertible Fluorescent Proteins

Berardozzi R, Adam V, Martins A, Bourgeois D

(2016). Journal of the American Chemical Society, 138(2) , 558-565. doi: 10.1021/jacs.5b09923. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for mEos2-A69T
Search RIKEN BRC for mEos2-A69T

Change history

Something missing or incorrect? Submit a change Submit a change