compare

Comparison List

dClover2

a.k.a. Clover1.5 (G160S)

dClover2 is a fluorescent protein published in 2016, derived from Aequorea victoria. It is reported to be a dimer.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea victoria 26.9 kDa -

FPbase ID: OMXYJ

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

dClover2 Sequence

BLAST

dClover2 was derived from Clover1.5 with the following mutations: G160S
amino acid numbers relative to avGFP. show relative to Clover1.5

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTFGYGVACFSRYPDHMKQHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHYVYITADKQKNSIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSHQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for dClover2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Improving brightness and photostability of green and red fluorescent proteins for live cell imaging and FRET reporting

Bajar Bt, Wang Es, Lam Aj, Kim Bb, Jacobs Cl, Howe Es, Davidson Mw, Lin Mz, Chu J

(2016). Scientific Reports, 6(1) , 20889. doi: 10.1038/srep20889. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change