compare

Comparison List

mCherry-XL

mCherry-XL is a basic (constitutively fluorescent) red fluorescent protein published in 2022, derived from Discosoma sp.. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.7 kDa -

FPbase ID: HZMZV

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
558 589 72,000 0.7 50.4 4.6   3.9
Edit States/Attributes

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
55.0 10.0 (W/cm2) LED Widefield E.Coli 25.0 Mukherjee et al. (2022)
A caution on interpretation of photostability measurements
Add photostability info

mCherry-XL Sequence

BLAST

mCherry-XL was derived from mCherry with the following mutations: W143S/I161V/Q163Y/I197R
amino acid numbers relative to DsRed. show relative to mCherry

MVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGSEASSERMYPEDGALKGEVKYRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNRKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

No excerpts have been added for mCherry-XL
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Directed evolution of a bright variant of mCherry: Suppression of non-radiative decay by fluorescence lifetime selections

Mukherjee S, Manna P, Hung S-T, Vietmeyer F, Friis P, Palmer A, Jimenez R

(2022). , , . doi: 10.26434/chemrxiv-2022-v3t03. Article

Additional References

  1. Directed Evolution of a Bright Variant of mCherry: Suppression of Nonradiative Decay by Fluorescence Lifetime Selections

    Mukherjee S, Manna P, Hung S-T, Vietmeyer F, Friis P, Palmer Ae, Jimenez R

    (2022). The Journal of Physical Chemistry B, , . doi: 10.1021/acs.jpcb.2c01956. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change