compare

Comparison List

Kaede

a.k.a. tgeoRFP

Kaede is a photoconvertible green/yellow fluorescent protein published in 2002, derived from Trachyphyllia geoffroyi. It has moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Tetramer Trachyphyllia geoffroyi 25.7 kDa -

FPbase ID: Q31FH

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Red 572 580 60,400 0.33 19.93 5.6   4.2
Green 508 518 98,800 0.88 86.94 5.6   3.4

Transitions

From To Switch λ
Green Red 380

Photostability

No photostability measurements available ... add one!

Kaede Sequence

MSLIKPEMKIKLLMEGNVNGHQFVIEGDGKGHPFEGKQSMDLVVKEGAPLPFAYDILTTAFHYGNRVFAKYPDHIPDYFKQSFPKGFSWERSLMFEDGGVCIATNDITLKGDTFFNKVRFDGVNFPPNGPVMQKKTLKWEASTEKMYLRDGVLTGDITMALLLKGDVHYRCDFRTTYKSRQEGVKLPGYHFVDHCISILRHDKDYNEVKLYEHAVAHSGLPDNVK
GenBank: BAC20344

Excerpts

No excerpts have been added for Kaede
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

An optical marker based on the UV-induced green-to-red photoconversion of a fluorescent protein

Ando R, Hama H, Yamamoto-Hino M, Mizuno H, Miyawaki A

(2002). Proceedings of the National Academy of Sciences, 99(20) , 12651-12656. doi: 10.1073/pnas.202320599. Article   Pubmed

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change