compare

Comparison List

IrisFP-M159A

IrisFP-M159A is a photoswitchable green fluorescent protein published in 2015, derived from Lobophyllia hemprichii. It has low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Lobophyllia hemprichii 25.6 kDa -

FPbase ID: T44HU

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 484 513 62,800 0.18 11.3 4.7    
Green (off)              

Transitions

From To Switch λ
Green (off) Green 405
Green Green (off) 488

Photostability

No photostability measurements available ... add one!

IrisFP-M159A Sequence

IrisFP-M159A was derived from IrisFP with the following mutations: M159A

MSAIKPDMKINLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFHYGNRVFAEYPDHIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFHGVNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDITAALLLEGNAHYRCDSRTTYKAKEKGVKLPGYHLVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for IrisFP-M159A
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Rational design of enhanced photoresistance in a photoswitchable fluorescent protein

Duan C, Byrdin M, El Khatib M, Henry X, Adam V, Bourgeois D

(2015). Methods and Applications in Fluorescence, 3(1) , 014004. doi: 10.1088/2050-6120/3/1/014004. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change