compare

Comparison List

GFP (S65T)

GFP (S65T) is a basic (constitutively fluorescent) green fluorescent protein published in 1995, derived from Aequorea victoria.
+
GFP (S65T) Spectrum Fluorescent protein GFP (S65T) excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea victoria 26.9 kDa -

FPbase ID: B6J33

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
490 510 55,000 0.64 35.2      

Photostability

No photostability measurements available ... add one!

GFP (S65T) Sequence

GFP (S65T) was derived from avGFP with the following mutations: S65T

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for GFP (S65T)
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Improved green fluorescence

Heim R, Cubitt Ab, Tsien Ry

(1995). Nature, 373(6516) , 663-664. doi: 10.1038/373663b0. Article   Pubmed

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change