compare

Comparison List

GFP (S65T)

GFP (S65T) is a basic (constitutively fluorescent) green fluorescent protein published in 1995, derived from Aequorea victoria.
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea victoria 26.9 kDa -

FPbase ID: B6J33

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
490 510 55,000 0.64 35.2      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

GFP (S65T) Sequence

BLAST

GFP (S65T) was derived from avGFP with the following mutations: S65T

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for GFP (S65T)
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Improved green fluorescence

Heim R, Cubitt Ab, Tsien Ry

(1995). Nature, 373(6516) , 663-664. doi: 10.1038/373663b0. Article   Pubmed

Additional References

  1. Comparative assessment of fluorescent proteins for in vivo imaging in an animal model system

    Heppert Jk, Dickinson Dj, Pani Am, Higgins Cd, Steward A, Ahringer J, Kuhn Jr, Goldstein B

    (2016). Molecular Biology of the Cell, 27(22) , 3385-3394. doi: 10.1091/mbc.e16-01-0063. Article   Pubmed

  2. Use of the green fluorescent protein and its mutants in quantitative fluorescence microscopy

    Patterson Gh, Knobel Sm, Sharif Wd, Kain Sr, Piston Dw

    (1997). Biophysical Journal, 73(5) , 2782-2790. doi: 10.1016/s0006-3495(97)78307-3. Article

  3. Engineering green fluorescent protein for improved brightness, longer wavelengths and fluorescence resonance energy transfer

    Heim R, Tsien Ry

    (1996). Current Biology, 6(2) , 178-182. doi: 10.1016/s0960-9822(02)00450-5. Article

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change