compare

Comparison List

FR-1

FR-1 is a basic (constitutively fluorescent) red fluorescent protein published in 2018, derived from Entacmaea quadricolor.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 25.6 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
569 594 84,900 0.34 28.87     2.3

Photostability

no photostability measurements available ... add one!

FR-1 Sequence

MVSELIKENMPMKLYMEGTINNHHFKCTSEGEGKPYEGTQTMRIKVVEGGPPPFAFDILATSFMYGSRTFIKHPPGIPDFFKQSFPEGFTWERVTTYEDGGVLTATQDTSLQDGCLIYNVKVRGVNFPANGPVMQKKTLGWEASTETMYPADGGLEGACDMALKLVGGGHLICNLETTYRSKKPATNLKMPGVYNVDHRLERIKEADDETYVEQHEVAVARYSTGGAGDGGK

Excerpts

No excerpts have been added for FR-1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change