compare

Comparison List

EBFP1.5

EBFP1.5 is a basic (constitutively fluorescent) blue fluorescent protein published in 2007, derived from Aequorea victoria. It has low acid sensitivity.
+
Aggregation Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.8 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
381 449 43,000 0.53 22.79 4.8    

Photostability

no photostability measurements available ... add one!

EBFP1.5 Sequence

EBFP1.5 was derived from EBFP1.2 with the following mutations: F145H/H148N/M153A
amino acid numbers relative to avGFP. show relative to EBFP1.2

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNHNSNNVYIAADKQKNGIKVNFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSVLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for EBFP1.5
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Something missing or incorrect? Submit a change Submit a change