compare

Comparison List

22G

22G is a green fluorescent protein isolated from Pectiniidae (Echinophyllia Sp) cDNA, published in 2004. It is the wild-type oligomeric form of the protein known as Dronpa.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Tetramer Echinophyllia sp. SC22 25.5 kDa -

FPbase ID: 1UZQ4

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

22G Sequence

BLAST
MSVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTTVFCYGNRVFAKYPENIVDYFKQSFPEGYSWERSMNYEDGGICIATNDITLDGDCFIYEIRFDGVNFPANGPVMQKRTVKWEPSTEKLYVRDGVLKGDVNMALLLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHRIEIKSHDKDYNNVNLHEHAEAHSGLPRQAK

Structure

Deposited: ,
Chromophore:

Excerpts

We prepared a cDNA library from Pectiniidae, a species of coral that emits faint fluorescence upon irradiation with ultraviolet light. Approximately 300,000 bacterial colonies containing individual cDNA clones were screened for fluorescence. A single clone (22G) encoding a greenish fluorescent protein with highest homology to mcavGFP (Labas et al 2002) (74.6%) was identified.

Ando (2004)

Primary Reference

Regulated Fast Nucleocytoplasmic Shuttling Observed by Reversible Protein Highlighting

Ando R

(2004). Science, 306(5700) , 1370-1373. doi: 10.1126/science.1102506. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change