compare

Comparison List

dKeima570

dKeima570 is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2006, derived from Montipora sp. 20.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Dimer Montipora sp. 20 25.0 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
440 570 14,000 0.15 2.1      

Photostability

no photostability measurements available ... add one!

dKeima570 Sequence

MVSVIAKQMTYKVYMSGTVNGHYFEVEGDGKGKPYEGEQTVKLTVTKGGPLPFAWDILSPLMCYGSIPFTKYPEDIPDYVKQSFPEGYTWERTMNFEDGAVCTVSNDSSIQGNCFIYNVKISGTNFPPNGPVMQKKTQGWEPSTERLFARDGMLIGNDYMALKLEGGGHYLCEFKSTYKAKKPVRMPGYHYVDRKLDVTSHNRDYTSVEQCEIAIARHSLLG
GenBank: BAE94262
UniProtKB: Q1JU63
IPG: 5680967

Excerpts

No excerpts have been added for dKeima570
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change