compare

Comparison List

dKeima

dKeima is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2006, derived from Montipora sp. 20. It has high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Montipora sp. 20 25.1 kDa -

FPbase ID: LMJV4

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
440 616 24,600 0.31 7.63 6.5   2.78

Photostability

No photostability measurements available ... add one!

dKeima Sequence

dKeima was derived from tKeima with the following mutations: V123T/V191I
amino acid numbers relative to Montipora sp. #20. show relative to tKeima

MVSVIAKQMTYKVYMSGTVNGHYFEVEGDGKGKPYEGEQTVKLTVTKGGPLPFAWDILSPLFQYGSIPFTKYPEDIPDYVKQSFPEGYTWERTMNFEDGAVCTVSNDSSIQGNCFIYNVKISGTNFPPNGPVMQKKTQGWEPSTERLFARDGMLIGNDYMALKLEGGGHYLCEFKSTYKAKKPVRMPGYHYIDRKLDVTSHNRDYTSVEQCEIAIARHSLLG
GenBank: BAE93225
UniProtKB: Q1JV71
IPG: 5593673

Excerpts

No excerpts have been added for dKeima
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change