compare

Comparison List

dKeima

dKeima is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2006, derived from Montipora sp. 20. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Dimer Montipora sp. 20 25.1 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
440 616 24,600 0.31 7.63 6.5   2.78

Photostability

no photostability measurements available ... add one!

dKeima Sequence

MVSVIAKQMTYKVYMSGTVNGHYFEVEGDGKGKPYEGEQTVKLTVTKGGPLPFAWDILSPLFQYGSIPFTKYPEDIPDYVKQSFPEGYTWERTMNFEDGAVCTVSNDSSIQGNCFIYNVKISGTNFPPNGPVMQKKTQGWEPSTERLFARDGMLIGNDYMALKLEGGGHYLCEFKSTYKAKKPVRMPGYHYIDRKLDVTSHNRDYTSVEQCEIAIARHSLLG
GenBank: BAE93225
UniProtKB: Q1JV71
IPG: 5593673

Excerpts

No excerpts have been added for dKeima
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change