compare

Comparison List

dKeima570

dKeima570 is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2006, derived from Montipora sp. 20.
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Montipora sp. 20 25.0 kDa -

FPbase ID: BUJNN

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
440 570 14,000 0.15 2.1      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

dKeima570 Sequence

BLAST

dKeima570 was derived from dKeima with the following mutations: F61M/Q62C
amino acid numbers relative to Montipora sp. #20. show relative to dKeima

Note: Note: there is inconsistency between the dKeima570 sequence reported in the text and in Supp. Fig. 1 of Kogure et al 2006 (which reports dKeima570 as dKeima + F61M/Q62C) and the GenBank BAE94262 sequence, which reverts isoleucine 191 back to valine. Here we use the sequence reported in the paper.

MVSVIAKQMTYKVYMSGTVNGHYFEVEGDGKGKPYEGEQTVKLTVTKGGPLPFAWDILSPLMCYGSIPFTKYPEDIPDYVKQSFPEGYTWERTMNFEDGAVCTVSNDSSIQGNCFIYNVKISGTNFPPNGPVMQKKTQGWEPSTERLFARDGMLIGNDYMALKLEGGGHYLCEFKSTYKAKKPVRMPGYHYIDRKLDVTSHNRDYTSVEQCEIAIARHSLLG
GenBank: BAE94262
UniProtKB: Q1JU63
IPG: 5680967

Excerpts

No excerpts have been added for dKeima570
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A fluorescent variant of a protein from the stony coral Montipora facilitates dual-color single-laser fluorescence cross-correlation spectroscopy

Kogure T, Karasawa S, Araki T, Saito K, Kinjo M, Miyawaki A

(2006). Nature Biotechnology, 24(5) , 577-581. doi: 10.1038/nbt1207. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change