compare

Comparison List

dendFP

a.k.a. dendRFP, dendGFP

dendFP is a photoconvertible green fluorescent protein published in 2002, derived from Dendronephthya sp.. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Dendronephthya sp. 25.8 kDa -

FPbase ID: JTXCJ

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Green 492 508 90,000 0.65 58.5 6.5    
Red 557 575 35,000 0.68 23.8 5.2    
Edit States/Attributes

Transitions

From To Switch λ
Green Red 405
Edit state transitions

Photostability

No photostability measurements available ... add one!

dendFP Sequence

BLAST
MNLIKEDMRVKVHMEGNVNGHAFVIEGEGKGKPYEGTQTLNLTVKEGAPLPFSYDILTTALHYGNRVFTKYPEDIPDYFKQSFPEGYSWERTMTYEDKGICTIRSDISLEGDCFFQNVRFNGMNFPPNGPVMQKKTLKWEPSTEKLHVRDGLLVGNINMALLLEGGGHYLCDFKTTYKAKKVVQLPDYHFVDHRIEILSNDSDYNKVKLYEHGVARYSPLPSQAW
GenBank: AAM10625
UniProtKB: Q8T6U0
IPG: 4560782

Excerpts

No excerpts have been added for dendFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Diversity and evolution of the green fluorescent protein family

Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

(2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

Additional References

  1. Crystal structure of the fluorescent protein fromDendronephthyasp. in both green and photoconverted red forms

    Pletneva Nv, Pletnev S, Pakhomov Aa, Chertkova Rv, Martynov Vi, Muslinkina L, Dauter Z, Pletnev Vz

    (2016). Acta Crystallographica Section D Structural Biology, 72(8) , 922-932. doi: 10.1107/s205979831601038x. Article   Pubmed

  2. Spectral Diversity of Fluorescent Proteins from the Anthozoan Corynactis californica

    Schnitzler Ce, Keenan Rj, Mccord R, Matysik A, Christianson Lm, Haddock Shd

    (2008). Marine Biotechnology, 10(3) , 328-342. doi: 10.1007/s10126-007-9072-7. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change