compare

Comparison List

CyRFP1

similar: mCyRFP1

CyRFP1 is a fluorescent protein published in 2016, derived from Entacmaea quadricolor. It is reported to be a dimer.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Dimer Entacmaea quadricolor 26.4 kDa -

FPbase ID: A8RF9

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

CyRFP1 Sequence

CyRFP1 was derived from CyOFP1 with the following mutations: H61M
amino acid numbers relative to eqFP578. show relative to CyOFP1

MVSKGEELIKENMRSKLYLEGSVNGHQFKCTHEGEGKPYEGKQTNRIKVVEGGPLPFAFDILATMFMYGSKVFIKYPADLPDYFKQSFPEGFTWERVMVFEDGGVLTATQDTSLQDGELIYNVKLRGVNFPANGPVMQKKTLGWEPSTETMYPADGGLEGRCDKALKLVGGGHLHVNFKTTYKSKKPVKMPGVHYVDRRLERIKEADNETYVEQYEHAVARYSNLGGGMDELYK
GenBank: AOY07766

Excerpts

No excerpts have been added for CyRFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Something missing or incorrect? Submit a change Submit a change