compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

CyRFP1

a.k.a. cyan-excitable red fluorescent protein

CyRFP1 is a basic (constitutively fluorescent) yellow fluorescent protein published in 2016, derived from Entacmaea quadricolor. It is reported to be a very rapidly-maturing weak dimer.

⁺

Oligomerization	Organism	Molecular Weight	Cofactor
Weak dimer	Entacmaea quadricolor	26.4 kDa	-

FPbase ID: A8RF9

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
529	588	48,000	0.76	36.48		12.0

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

CyRFP1 Sequence

BLAST

CyRFP1 was derived from CyOFP1 with the following mutations: H65M/V125LH61M/V121L
amino acid numbers relative to CyOFP1eqFP578. show relative to eqFP578 show relative to CyOFP1

MVSKGEELIKENMRSKLYLEGSVNGHQFKCTHEGEGKPYEGKQTNRIKVVEGGPLPFAFDILATMFMYGSKVFIKYPADLPDYFKQSFPEGFTWERVMVFEDGGVLTATQDTSLQDGELIYNVKLRGVNFPANGPVMQKKTLGWEPSTETMYPADGGLEGRCDKALKLVGGGHLHVNFKTTYKSKKPVKMPGVHYVDRRLERIKEADNETYVEQYEHAVARYSNLGGGMDELYK

GenBank: AOY07766

Excerpts

A major advantage of CyRFP1 and mCyRFP1 is their ability to be coexcited along with EGFP while their emissions are easily separable from those of EGFP.

Laviv et al. (2016)

Primary Reference

Simultaneous dual-color fluorescence lifetime imaging with novel red-shifted fluorescent proteins

Laviv T, Kim Bb, Chu J, Lam Aj, Lin Mz, Yasuda R

(2016). Nature Methods, 13(12) , 989-992. doi: 10.1038/nmeth.4046. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for CyRFP1
Search RIKEN BRC for CyRFP1

Change history

Something missing or incorrect? Submit a change Submit a change