compare

Comparison List

mCyRFP1

similar: CyRFP1

mCyRFP1 is a basic (constitutively fluorescent) yellow fluorescent protein published in 2016, derived from Entacmaea quadricolor. It has moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Entacmaea quadricolor 26.4 kDa -

FPbase ID: UQH8C

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
528 594 27,000 0.65 17.55 5.6   3.71

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
45.0   Laviv et al. (2016)

mCyRFP1 Sequence

mCyRFP1 was derived from CyRFP1 with the following mutations: N41A/A161K
amino acid numbers relative to eqFP578. show relative to CyRFP1

MVSKGEELIKENMRSKLYLEGSVNGHQFKCTHEGEGKPYEGKQTARIKVVEGGPLPFAFDILATMFMYGSKVFIKYPADLPDYFKQSFPEGFTWERVMVFEDGGVLTATQDTSLQDGELIYNVKLRGVNFPANGPVMQKKTLGWEPSTETMYPADGGLEGRCDKKLKLVGGGHLHVNFKTTYKSKKPVKMPGVHYVDRRLERIKEADNETYVEQYEHAVARYSNLGGGMDELYK
GenBank: AOY07765

Excerpts

No excerpts have been added for mCyRFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change