compare

Comparison List

cgigCP

cgigCP is a fluorescent protein published in 2002, derived from Condylactis gigantea.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Condylactis gigantea 25.4 kDa -

FPbase ID: 24DFB

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

cgigCP Sequence

MAGLLKESMRIKIYMEGTVNGYHFKCEGEGDGNPFEGTQNMRIRVTEGAPLPFAFDILSPCCAYGSKTFIKHTSGIPDYFKQSFPEGFTWERTTIYEDGGVLTAHQDTSLEGNCLIYKVKVLGTNFPADGPVMKKISGGWEPCTEIVYQDNGVLRGRNVMALKVSGRPPLICHLHSTYRSKKACALTMPGFHFADLRIQMPKKKKDEYFELYEASVARYSDVPEKAT
GenBank: AAL27537
UniProtKB: Q95W86
IPG: 594528

Excerpts

No excerpts have been added for cgigCP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Diversity and evolution of the green fluorescent protein family

Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

(2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change