compare

Comparison List

cgigCP

a.k.a. cgCP

cgigCP is a fluorescent protein published in 2001, derived from Condylactis gigantea.
+
cgigCP Spectrum Fluorescent protein cgigCP excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
? Condylactis gigantea 25.4 kDa -

FPbase ID: 24DFB

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
571            

Photostability

No photostability measurements available ... add one!

cgigCP Sequence

MAGLLKESMRIKIYMEGTVNGYHFKCEGEGDGNPFEGTQNMRIRVTEGAPLPFAFDILSPCCAYGSKTFIKHTSGIPDYFKQSFPEGFTWERTTIYEDGGVLTAHQDTSLEGNCLIYKVKVLGTNFPADGPVMKKISGGWEPCTEIVYQDNGVLRGRNVMALKVSGRPPLICHLHSTYRSKKACALTMPGFHFADLRIQMPKKKKDEYFELYEASVARYSDVPEKAT
GenBank: AAL27537
UniProtKB: Q95W86
IPG: 594528

Excerpts

No excerpts have been added for cgigCP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Chromophore Environment Provides Clue to “Kindling Fluorescent Protein” Riddle

    Chudakov Dm, Feofanov Av, Mudrik Nn, Lukyanov S, Lukyanov Ka

    (2003). Journal of Biological Chemistry, 278(9) , 7215-7219. doi: 10.1074/jbc.m211988200. Article

  2. Diversity and evolution of the green fluorescent protein family

    Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

    (2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change