compare

Comparison List

bsDronpa

bsDronpa is a photoswitchable cyan fluorescent protein published in 2008, derived from Echinophyllia sp. SC22.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Echinophyllia sp. SC22 25.4 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
On 460 504 45,000 0.5 22.5      
Off              

Transitions

From To Switch λ
Off On 405
On Off 488

Photostability

no photostability measurements available ... add one!

bsDronpa Sequence

bsDronpa was derived from rsFastLime with the following mutations: V60A/A69T/D112N/P141Q/G155S/M159C/F173C

MSVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTTAFCYGNRVFTKYPENIVDYFKQSFPEGYSWERSMNYEDGGICNATNDITLDGNCYIYEIRFDGVNFPANGPVMQKRTVKWEQSTEKLYVRDGVLKSDGNCALSLEGGGHYRCDCKTTYKAKKVVQLPDYHFVDHHIEIKSHDKDYSNVNLHEHAEAHSELPRQAK

Excerpts

During the screen for Padron*, we identified a mutant with a cysteine residue at position 159 that was negatively switchable but exhibited a broad asymmetric absorption spectrum that was shifted to shorter wavelengths. After further improvements, we obtained a bright green fluorescent Dronpa variant with eight mutations, displaying an absorption maximum at 460 nm in the on-state. Termed bsDronpa (for broad-absorption-spectrum Dronpa), this RSFP combines a relatively large Stokes shift of 44 nm with a broad on-state absorption spectrum. It is efficiently excited with UV light, while maintaining good switching characteristics.

Andresen et al. (2008)

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change