compare

Comparison List

amFP486

a.k.a. amajGFP

amFP486 is a basic (constitutively fluorescent) cyan fluorescent protein published in 1999, derived from Anemonia majano.
+
Oligomerization Organism Molecular Weight Cofactor
Tetramer Anemonia majano 25.3 kDa -

FPbase ID: 1M48O

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
458 486 40,000 0.24 9.6      

Photostability

No photostability measurements available ... add one!

amFP486 Sequence

MALSNKFIGDDMKMTYHMDGCVNGHYFTVKGEGNGKPYEGTQTSTFKVTMANGGPLAFSFDILSTVFKYGNRCFTAYPTSMPDYFKQAFPDGMSYERTFTYEDGGVATASWEISLKGNCFEHKSTFHGVNFPADGPVMAKKTTGWDPSFEKMTVCDGILKGDVTAFLMLQGGGNYRCQFHTSYKTKKPVTMPPNHVVEHRIARTDLDKGGNSVQLTEHAVAHITSVVPF
GenBank: AAF03371
UniProtKB: Q9U6Y6
IPG: 1173879

Structure

Deposited: ,
Chromophore:

Excerpts

Table 1: Fluorescence quantum yield of amFP486: 0.75 (0.24 (Matz et al., 1999), 0.71 (Henderson et al., 2005))

Molina et al. (2017)

Primary Reference

Additional References

  1. Crystal structures and mutational analysis of amFP486, a cyan fluorescent protein from Anemonia majano

    Henderson Jn, Remington Sj

    (2005). Proceedings of the National Academy of Sciences, 102(36) , 12712-12717. doi: 10.1073/pnas.0502250102. Article   Pubmed

  2. Diversity and evolution of the green fluorescent protein family

    Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

    (2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change