compare

Comparison List

AausFP1

AausFP1 is a basic (constitutively fluorescent) green fluorescent protein, derived from Aequorea australis. It has moderate acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea australis 25.7 kDa -

FPbase ID: C2FJQ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
504 510 170,000 0.97 164.9 6.0    

Photostability

No photostability measurements available ... add one!

AausFP1 Sequence

MSYGALLFREKIPYVVEMEGDVEGMKFSVRGKGHGDANTGKIEASFICTTGELPVPWSSILTTVTYGAQCFAKYPNDIKDYPKSAMPEGYVQERTITFENDGVYKTRAEVTYEKGSVYNRVTLNGSGFKKGGNILGKKLEFNYNPHCIYVLPDVQNNGIKCYINIVHDVIGGGQIIAAHQQLNTPLGGGPVDIPHYHHIQAHTILSKDPKETRDHMNVVEVFRAIDCKTAYA

Excerpts

No excerpts have been added for AausFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change