compare

Comparison List

mMiCy

a.k.a. mMidori-ishi Cyan

similar: MiCy

mMiCy is a basic (constitutively fluorescent) cyan fluorescent protein published in 2004, derived from Acropora sp. #30. It has high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Acropora sp. #30 26.0 kDa -

FPbase ID: ZS5CR

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
470 496 22,150 0.7 15.5 7.0    

Photostability

No photostability measurements available ... add one!

mMiCy Sequence

MVSYSKQGIAQEMRTKYRMEGSVNGHEFTIEGVGTGNPYEGKQTSELVIIKPKGKPLPFSFDILSTVFQYGNRCFTKYPADMPDYFKQAFPDGMSYERSFLFEDGGVATASWSIRLEGNCFIHNSIYHGTNFPADGPVMKKQTIGWDKSSEKMSVAKEVLRGDVTQFLLLEGGGYQRCQLHSTYKTEKPVAMPPSHVVEHQIVRTDLGQTAKGFKVKLEEHAEAHVNPLKVK

Excerpts

No excerpts have been added for mMiCy
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change