compare

Comparison List

dClover2 A206K

dClover2 A206K is a fluorescent protein published in 2016, derived from Aequorea victoria. It is reported to be a dimer.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea victoria 26.9 kDa -

FPbase ID: T4DJM

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

dClover2 A206K Sequence

BLAST

dClover2 A206K was derived from dClover2 with the following mutations: A206K
amino acid numbers relative to avGFP. show relative to dClover2

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTFGYGVACFSRYPDHMKQHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHYVYITADKQKNSIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSHQSKLSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for dClover2 A206K
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Improving brightness and photostability of green and red fluorescent proteins for live cell imaging and FRET reporting

Bajar Bt, Wang Es, Lam Aj, Kim Bb, Jacobs Cl, Howe Es, Davidson Mw, Lin Mz, Chu J

(2016). Scientific Reports, 6(1) , 20889. doi: 10.1038/srep20889. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change