compare

Comparison List

mK-GO

a.k.a. mKusabira Green Orange

mK-GO is a multistate orange fluorescent protein published in 2010, derived from Verrillofungia concinna. It has low acid sensitivity.
+
mK-GO Spectrum Fluorescent protein mK-GO excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Verrillofungia concinna 24.5 kDa -

FPbase ID: SBO48

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Late 548 561 42,000     4.8 360.0  
Early 500 509 35,900     6.0    
Edit state transitions

Photostability

No photostability measurements available ... add one!

mK-GO Sequence

mK-GO was derived from mKO with the following mutations: K48E/P69V/K184E/K187E/S191D/S195G
amino acid numbers relative to KO. show relative to mKO

MVSVIKPEMKMRYYMDGSVNGHEFTIEGEGTGRPYEGHQEMTLRVTMAEGGPMPFAFDLVSHVFCYGHRVFTKYPEEIPDYFKQAFPEGLSWERSLEFEDGGSASVSAHISLRGNTFYHKSKFTGVNFPADGPIMQNQSVDWEPSTEKITASDGVLKGDVTMYLKLEGGGNHKCQFKTTYKAAKEILEMPGDHYIGHRLVRKTEGNITELVEDAVAHS

Excerpts

The ratio of orange per green fluorescence was lineally increased and reached at plateau at ∼10 h. The time for the half-maximal fluorescence development is ∼6 h which is faster than DsRed-based fluorescent timer

Tsuboi et al. (2009)

mK-GO is a monomeric version of fluorescent timer that is suitable for monitoring the age of the targeting protein.

Tsuboi et al. (2009)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change