compare

Comparison List

mTurquoise2-1710

mTurquoise2-1710 is a basic (constitutively fluorescent) green fluorescent protein published in 2017, derived from Aequorea victoria. It has low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.8 kDa -

FPbase ID: P38Q4

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
482 519 30,000 0.51 15.3 4.9    
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mTurquoise2-1710 Sequence

BLAST

mTurquoise2-1710 was derived from mTurquoise2 with the following mutations: A37V/I128T/Y145S/F146S/N164H/D173G/T203Y/D234G
amino acid numbers relative to avGFP. show relative to mTurquoise2

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDVTYGKLTLKFICTTGKLPVPWPTLVTTLSWGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGTDFKEDGNILGHKLEYNSSSDNVYITADKQKNGIKAHFKIRHNIEGGGVQLADHYQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFVTAAGITLGMGELYK

Excerpts

Fluorescence intensity remained almost constant over a wide pH range (5.3 to 11), but sharply decreased at pH values less than 5 (apparent pKa 4.9)

Gorbachev et al. (2017)

Primary Reference

Green fluorescent protein with tryptophan-based chromophore stable at low pH

Gorbachev Da, Sarkisyan Ks, Mishin As, Lukyanov Ka

(2017). Russian Journal of Bioorganic Chemistry, 43(2) , 220-222. doi: 10.1134/s1068162017010034. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change