compare

Comparison List

mSandy2

mSandy2 is a basic (constitutively fluorescent) red fluorescent protein published in 2022, derived from Discosoma sp..

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 25.7 kDa -

FPbase ID: OS9DX

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
581 606 79,000 0.35 27.65      

Photostability

No photostability measurements available ... add one!

mSandy2 Sequence

MAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSLQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLHGTNFPSDGPVMQKKTMGSEASSERMYPEDGALKGEVKVRFKLKDGGHYVAEVKTTYKAKKPVQLPGAYYANIKMDITSHNEDYTIVEQYERCEGRHSTGGMDELYK

Excerpts

After three rounds of directed evolution (Methods), we isolated mSandy2 (Table 1 and Fig. 2), a variant whose emission wavelength is not significantly altered but that displays an absolute quantum yield increase of 0.09 relative to mSandy1, making it approximately 33% brighter than its parent. mSandy2 is also 40% brighter than mCherry, an RFP that emits at a similar wavelength. However, chromophore maturation in mSandy2 is less efficient than in either mSandy1 or mCherry, as evidenced by the peaks at approximately 390 and 510 nm in its absorption spectrum (Fig. 2d) that correspond to neutral and anionic green chromophores (ESI Fig. 5†), respectively.

Legault et al. (2022)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change