compare

Comparison List

mGrape3

mGrape3 is a basic (constitutively fluorescent) far red fluorescent protein published in 2009, derived from Discosoma sp.. It has high acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.8 kDa -

FPbase ID: O351D

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
608 646 40,000 0.03 1.2 7.0    
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mGrape3 Sequence

BLAST

mGrape3 was derived from mGrape2 with the following mutations: V16T/R17H/F65M
amino acid numbers relative to DsRed. show relative to mGrape2

MVSKGEENNMAVIKEFMRFKTHMEGSVNGHEFEIEGKGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQMMYGSKAYVKHPPDIPDYMKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLHGTNFPSDGPVMQKKTMGWEASSERLYPEDGALKGEVKMRLKLKDGGHYDAEVKTTYMAKKPVQLPGAYKLDYKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

No excerpts have been added for mGrape3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Autofluorescent Proteins with Excitation in the Optical Window for Intravital Imaging in Mammals

Lin Mz, Mckeown Mr, Ng H-L, Aguilera Ta, Shaner Nc, Campbell Re, Adams Sr, Gross La, Ma W, Alber T, Tsien Ry

(2009). Chemistry & Biology, 16(11) , 1169-1179. doi: 10.1016/j.chembiol.2009.10.009. Article   Pubmed

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change