compare

Comparison List

mGrape2

mGrape2 is a basic (constitutively fluorescent) far red fluorescent protein published in 2009, derived from Discosoma sp.. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.8 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
605 636 33,000 0.03 0.99 6.3    

Photostability

no photostability measurements available ... add one!

mGrape2 Sequence

mGrape2 was derived from mGrape1 with the following mutations: A2_D6delinsVSKGEENNMA/E32K/A77P/L83M/R125H/I161V/A177V/A225G/*224MextDELYK
amino acid numbers relative to DsRed. show relative to mGrape1

MVSKGEENNMAVIKEFMRFKVRMEGSVNGHEFEIEGKGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPPDIPDYMKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLHGTNFPSDGPVMQKKTMGWEASSERLYPEDGALKGEVKMRLKLKDGGHYDAEVKTTYMAKKPVQLPGAYKLDYKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

No excerpts have been added for mGrape2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change