compare

Comparison List

mGrape2

mGrape2 is a basic (constitutively fluorescent) far red fluorescent protein published in 2009, derived from Discosoma sp.. It has high acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer Discosoma sp. 26.8 kDa -

FPbase ID: H6RGM

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
605 636 33,000 0.03 0.99 6.3    
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mGrape2 Sequence

BLAST

mGrape2 was derived from mGrape1 with the following mutations: A2_D6delinsVSKGEENNMA/E32K/A77P/L83M/R125H/I161V/A177V/A225G/*224MextDELYK
amino acid numbers relative to DsRed. show relative to mGrape1

MVSKGEENNMAVIKEFMRFKVRMEGSVNGHEFEIEGKGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPPDIPDYMKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLHGTNFPSDGPVMQKKTMGWEASSERLYPEDGALKGEVKMRLKLKDGGHYDAEVKTTYMAKKPVQLPGAYKLDYKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK

Excerpts

No excerpts have been added for mGrape2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Autofluorescent Proteins with Excitation in the Optical Window for Intravital Imaging in Mammals

Lin Mz, Mckeown Mr, Ng H-L, Aguilera Ta, Shaner Nc, Campbell Re, Adams Sr, Gross La, Ma W, Alber T, Tsien Ry

(2009). Chemistry & Biology, 16(11) , 1169-1179. doi: 10.1016/j.chembiol.2009.10.009. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change